Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE FTKFPTKTGRRSLSRSISQSSTDSYSSAASYTDSSDDEVSPREKQQTNSK GSSNFCVKNIKQAEFGRREIEIAEQDMSALISLRKRAQGEKPLAGAKIVG CTHITAQTAVLIETLCALGAQCRWSACNIYSTQNEVAAALAEAGVAVFAW KGESEDDFWWCIDRCVNMDGWQANMILDDGGDLTHWVYKKYPNVFKKIRG IVEESVTGVHRLYQLSKAGKLCVPAMNVNDSVTKQKFDNLYCCRESILDG LKRTTDVMFGGKQVVVCGYGEVGKGCCAALKALGAIVYITEIDPICALQA CMDGFRVVKLNEVIRQVDVVITCTGNKNVVTREHLDRMKNSCIVCNMGHS NTEIDVTSLRTPELTWERVRSQVDHVIWPDGKRVVLLAEGRLLNLSCSTV PTFVLSITATTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPSF DAHLTELTDDQAKYLGLNKNGPFKPNYYRY
    • Amino acids

      1 to 530
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as AHCYL1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AA409031
    • AdoHcyase 2
    • Ahcy-rs3
    • AHCYL1
    • DC expressed AHCY like molecule
    • DC-expressed AHCY-like molecule
    • DCAL
    • Dendritic cell expressed AHCY like protein
    • Inositol 1,4,5-trisphosphate receptor-binding protein
    • IP3R binding protein released with inositol 1,4,5-trisphosphate
    • IRBIT
    • PRO0233
    • Putative adenosylhomocysteinase 2
    • S adenosyl L homocysteine hydrolase 2
    • S adenosylhomocysteine hydrolase like 1
    • S-adenosyl-L-homocysteine hydrolase 2
    • S-adenosylhomocysteine hydrolase-like protein 1
    • SAHH2_HUMAN
    • XPVKONA
    see all
  • Tissue specificity

    Expressed in dendritic cells.
  • Pathway

    Amino-acid biosynthesis; L-homocysteine biosynthesis; L-homocysteine from S-adenosyl-L-homocysteine: step 1/1.
  • Sequence similarities

    Belongs to the adenosylhomocysteinase family.
  • Developmental stage

    Expression increases markedly during activation of blood and skin DC (Langerhans cells), but is diminished in terminally differentiated tonsil DC.
  • Domain

    The PEST region is essential for the interaction with ITPR1. The PDZ-binding region is required for maximal interaction with ITPR1 and is also responsible for the IP3-insensitive interaction with ITPR1.
  • Cellular localization

    Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab153123 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153123 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up