Overview

  • Product name
    Recombinant Human IRIP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRAAVAASVGLSEGPAGSRSGRLFRPPSPAPAAPGARLLRLPGSGAVQAA SPERAGWTEALRAAVAELRAGAVVAVPTDTLYGLACAASCSAALRAVYRL KGRSEAKPLAVCLGRVADVYRYCRVRVPEGLLKDLLPGPVTLVMERSEEL NKDLNPFTPLVGIRIPDHAFMQDLAQMFEGPLALTSANLSSQASSLNVEE FQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALE STTAILQQKYGLLPSHASYL
    • Amino acids
      1 to 270
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164079 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as YRDC. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dopamine receptor-interacting protein 3
    • DRIP3
    • FLJ23476
    • FLJ26165
    • hIRIP
    • IRIP
    • Ischemia/reperfusion inducible protein
    • Ischemia/reperfusion-inducible protein homolog
    • mitochondrial
    • RP11-109P14.4
    • SUA5
    • yrdC
    • yrdC domain containing (E. coli)
    • yrdC domain containing protein mitochondrial
    • YrdC domain-containing protein
    • YRDC_HUMAN
    see all
  • Function
    May regulate the activity of some transporters.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the SUA5 family.
    Contains 1 YrdC-like domain.
  • Cellular localization
    Mitochondrion. Membrane. Predominantly localized in the plasma membrane.
  • Information by UniProt

Images

  • ab164079 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164079 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164079.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up