Overview

  • Product name

    Recombinant Human IRK-2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKN GQCNIEFANMDEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGI IFWVIAVAHGDLEPAEGRGRTPCVMQVHGFMAAFLFSIETQTTIGYGLRC VTEECPVAVFMVVAQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNA VVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQID IDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYE VPSTPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRS RDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
    • Molecular weight

      73 kDa including tags
    • Amino acids

      1 to 433

Specifications

Our Abpromise guarantee covers the use of ab132978 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as Kir2.2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP sensitive inward rectifier potassium channel 12
    • ATP-sensitive inward rectifier potassium channel 12
    • hIRK
    • Human high conductance inward rectifier potassium channel alpha
    • Inward rectifier K
    • Inward rectifier K(+) channel Kir2.2
    • Inward rectifier K(+) channel Kir2.2v
    • inwardly rectifying subfamily J member 12
    • IRK-2
    • IRK12_HUMAN
    • IRK2
    • KCNJ12
    • kcnj12x
    • KCNJN1
    • Kir2.2v
    • Potassium channel
    • Potassium channel inwardly rectifying subfamily J member 12
    • Potassium inwardly rectifying channel subfamily J member 12
    • Potassium inwardly rectifying channel,subfamily J inhibitor 1
    see all
  • Function

    Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium.
  • Sequence similarities

    Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ12 subfamily.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132978 stained with Coomassie Blue.

References

ab132978 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132978.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up