Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LYLNDYCHRGLRLPTSNNDPRFDGEDGDPEAEMESDCCPCQHPPPGQVLP PLEAQEASFQKKFENFLHNAITIPISPWKVTSINKSPQRDSGRHRRAAGP LRLGGNSSDF
    • Amino acids
      651 to 760
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158768 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • INSRR
    • INSRR_HUMAN
    • Insulin Receptor R
    • Insulin receptor related receptor precursor
    • Insulin receptor-related protein alpha chain
    • Insulin receptor-related protein beta chain
    • insulin receptor-related receptor
    • IR R
    • IR related receptor
    • IR-related receptor
    • IRR
    • Sir r
    • Sirr
    see all
  • Function
    This receptor probably binds an insulin related protein and has a tyrosine-protein kinase activity. It phosphorylates the insulin receptor substrates IRS-1 and IRS-2.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily.
    Contains 3 fibronectin type-III domains.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158768 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158768 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158768.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up