Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAK GYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNE LLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQG SKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEK QCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASN GATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMN GVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPK NSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGD LITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQG KSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQ GLDDYGARSMSR
    • Molecular weight

      82 kDa including tags
    • Amino acids

      1 to 512

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132159 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.

    Protein previously known as BAIAP2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BAI-associated protein 2
    • BAI1 associated protein 2
    • BAI1-associated protein 2
    • BAIAP 2
    • Baiap2
    • BAIP2_HUMAN
    • BAP2
    • Brain-specific angiogenesis inhibitor 1-associated protein 2
    • Fas ligand-associated factor 3
    • FLAF3
    • Insulin receptor substrate p53
    • Insulin receptor substrate p53/p58
    • Insulin receptor substrate protein of 53 kDa
    • IRS-58
    • IRSp53
    • IRSp53/58
    • Protein BAP2
    see all
  • Function

    Adapter protein that links membrane-bound small G-proteins to cytoplasmic effector proteins. Necessary for CDC42-mediated reorganization of the actin cytoskeleton and for RAC1-mediated membrane ruffling. Involved in the regulation of the actin cytoskeleton by WASF family members and the Arp2/3 complex. Plays a role in neurite growth. Acts syngeristically with ENAH to promote filipodia formation.
  • Tissue specificity

    Isoform 1 and isoform 4 are expressed almost exclusively in brain. Isoform 4 is barely detectable in placenta, prostate and testis. A short isoform is ubiquitous, with the highest expression in liver, prostate, testis and placenta.
  • Sequence similarities

    Contains 1 IMD (IRSp53/MIM homology) domain.
    Contains 1 SH3 domain.
  • Domain

    The IMD domain forms a coiled coil. The isolated domain can induce actin bundling and filopodia formation. In the absence of G-proteins intramolecular interaction between the IMD and the SH3 domain gives rise to an auto-inhibited state of the protein. Interaction of the IMD with RAC1 or CDC42 leads to activation.
    The SH3 domain interacts with ATN1, BAI1, WASF1, WASF2, SHANK1, DIAPH1 and ENAH.
  • Post-translational
    modifications

    Phosphorylated on tyrosine residues by INSR in response to insulin treatment.
  • Cellular localization

    Cytoplasm. Membrane. Cell projection > filopodium. Cell projection > ruffle. Detected throughout the cytoplasm in the absence of specific binding partners. Detected in filopodia and close to membrane ruffles.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132159 on a 12.5% gel stained with Coomassie Blue.

References

ab132159 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132159.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up