Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPS GVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRL TQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM NLRLRGG
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 157
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Mature form.

Specifications

Our Abpromise guarantee covers the use of ab173044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 99% HEPES, 0.58% Sodium chloride

    Supplied as a 0.2 µm Ø filtered solution.

General Info

  • Alternative names
    • G1P2
    • hUCRP
    • IFI 15
    • IFI15
    • Interferon alpha inducible protein
    • Interferon induced protein 15
    • Interferon induced protein IFI-15K
    • Interferon stimulated protein 15 kDa
    • Interferon, alpha-inducible protein (clone IFI-15K)
    • Interferon-induced 15 kDa protein
    • Interferon-induced 17 kDa protein
    • Interferon-induced 17-kDa/15-kDa protein
    • IP17
    • ISG 15
    • ISG15
    • ISG15 ubiquitin like modifier
    • ISG15_HUMAN
    • Ubiquitin cross-reactive protein
    • Ubiquitin-like protein ISG15
    • UCRP
    see all
  • Function
    Ubiquitin-like protein that is conjugated to intracellular target proteins after IFN-alpha or IFN-beta stimulation. Its enzymatic pathway is partially distinct from that of ubiquitin, differing in substrate specificity and interaction with ligating enzymes. ISG15 conjugation pathway uses a dedicated E1 enzyme, but seems to converge with the Ub conjugation pathway at the level of a specific E2 enzyme. Targets include STAT1, SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, EIF2AK2/PKR, MX1/MxA, and RIG-1. Deconjugated by USP18/UBP43. Shows specific chemotactic activity towards neutrophils and activates them to induce release of eosinophil chemotactic factors. May serve as a trans-acting binding factor directing the association of ligated target proteins to intermediate filaments. May also be involved in autocrine, paracrine and endocrine mechanisms, as in cell-to-cell signaling, possibly partly by inducing IFN-gamma secretion by monocytes and macrophages. Seems to display antiviral activity during viral infections.
    In response to IFN-tau secreted by the conceptus, may ligate to and regulate proteins involved in the release of prostaglandin F2-alpha (PGF), and thus prevent lysis of the corpus luteum and maintain the pregnancy.
  • Tissue specificity
    Detected in lymphoid cells, striated and smooth muscle, several epithelia and neurons.
  • Sequence similarities
    Contains 2 ubiquitin-like domains.
  • Cellular localization
    Cytoplasm. Secreted. UCRP conjugates seem to be noncovalently associated with the intermediate filaments and distributed in a punctate pattern. Also secreted.
  • Information by UniProt

References

ab173044 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up