Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HSDKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQ SDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVE
    • Amino acids
      261 to 358
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Islet 2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ10160
    • Insulin gene enhancer protein ISL 2
    • Insulin gene enhancer protein ISL-2
    • Insulin gene enhancer protein ISL2
    • ISL 2
    • ISL 2 transcription factor
    • ISL 2 transcription factor LIM/homeodomain
    • ISL LIM homeobox 2
    • ISL2
    • ISL2 transcription factor
    • ISL2 transcription factor LIM/homeodomain
    • ISL2_HUMAN
    • Islet 2
    • Islet-2
    • Islet2
    • SL2 transcription factor LIM/homeodomain (islet-2)
    see all
  • Function
    Transcriptional factor that defines subclasses of motoneurons that segregate into columns in the spinal cord and select distinct axon pathways.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
    Contains 2 LIM zinc-binding domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163890 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163890 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163890.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up