Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      29aa_Tag_GDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAAC LKCAECNQYLDESCTCFVRDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFV MRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLG AGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEKTTRVRTVLNEKQ LHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRSIM MKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWK VLSDFALQSDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSM VASPIEALEESGGGGSPGRRRRRRRRRRR
    • Molecular weight
      39 kDa
    • Amino acids
      2 to 349

Specifications

Our Abpromise guarantee covers the use of ab134882 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab134882 was refolded using “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains Nacl,EDTA,KCl,arginine,DTT and Glycerol

General Info

  • Alternative names
    • Insulin gene enhancer protein ISL 1
    • Insulin gene enhancer protein ISL-1
    • Insulin related protein
    • ISL 1
    • ISL LIM homeobox 1
    • ISL1
    • ISL1 transcription factor LIM homeodomain
    • ISL1 transcription factor, LIM/homeodomain
    • ISL1 transcription factor, LIM/homeodomain (islet 1)
    • ISL1_HUMAN
    • Islet-1
    • Islet1
    see all
  • Function
    Binds to one of the cis-acting domain of the insulin gene enhancer.
  • Tissue specificity
    Expressed in subsets of neurons of the adrenal medulla and dorsal root ganglion, inner nuclear and ganglion cell layers in the retina, the pineal and some regions of the brain.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
    Contains 2 LIM zinc-binding domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

References

ab134882 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134882.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up