Description

  • Product name

    Recombinant Human ISOC2 protein (denatured)
    See all ISOC2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab171594 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSEQYPQGLGPTVPELGTEGLRPLAKTCF SMVPALQQELDSRPQLRSVLLCGIEAQACILNTTLDLLDRGLQVHVVVDA CSSRSQVDRLVALARMRQSGAFLSTSEGLILQLVGDAVHPQFKEIQKLIK EPAPDSGLLGLFQGQNSLLH
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      59 to 205
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171594 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • FLJ18582
    • ISOC 2
    • ISOC2
    • ISOC2_HUMAN
    • Isochorismatase domain containing 2
    • Isochorismatase domain containing protein 2
    • Isochorismatase domain containing protein 2 mitochondrial
    • Isochorismatase domain-containing protein 2
    • mitochondrial
    see all
  • Sequence similarities

    Belongs to the isochorismatase family.
  • Cellular localization

    Mitochondrion. Cytoplasm. Nucleus. Localizes to the nucleus in the presence of CDKN2A.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171594 at 3µg.

References

ab171594 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171594.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up