Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      STTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISC ASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN
    • Amino acids
      78 to 177
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta 3 endonexin
    • Beta3 endonexin
    • Beta3 endonexin long form
    • CENP R
    • CENPR
    • CENPR_HUMAN
    • Centromere protein R
    • endonexin, Beta-3
    • HSU37139
    • Integrin beta 3 binding protein
    • Integrin beta 3 binding protein (beta3-endonexin)
    • NRIF 3
    • NRIF3
    • Nuclear receptor interacting factor 3
    • TAP 20
    • TAP20
    see all
  • Relevance
    ITGB3BP is a transcriptional coregulator that has both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. ITGB3BP also acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit. ITGB3BP induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization. It also acts as a component of the CENPH-CENPI centromeric complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation.
  • Cellular localization
    Isoform 1: Nucleus. Isoform 2: Nucleus. Isoform 3: Nucleus. Cytoplasm. Isoform 4: Cytoplasm. Note=Localizes in the centromeres. Isoform 3 is predominantly nuclear and weakly cytoplasmic.

Images

  • ab161637 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161637 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up