Recombinant Human ITIH3 protein (ab194042)

Description

  • Product name

    Recombinant Human ITIH3 protein
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab194042 was determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LPEGVANGIEVYSTKINSKVTSRFAHNVVTMRAVNRADTAKEVSFDVELP KTAFITNFTLTIDGVTYPGNVKEKEVAKKQYEKAVSQGKTAGLVKASGRK LEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVKHFEI EVDIFEPQGISMLDAEASFITNDLLGSALTKSFSGKKGHVSFKPSLDQQR SCPTCTDSLLNGDFTITYDVNRESPGNVQIVNGYFVHFFAPQGLPVVPKN VAFVIDISGSMAGRKLEQTKEALLRILEDMQEEDYLNFILFSGDVSTWKE HLVQATPENLQEARTFVKSMEDKGMTNINDGLLRGISMLNKAREEHRIPE RSTSIVIMLTDGDANVGESRPEKIQENVRNAIGGKFPLYNLGFGNNLNYN FLENMALENHGFARRIYEDSDADLQLQGFYEEVANPLLTGVEMEYPENAI LDLTQNTYQHFYDGSEIVVAGRLVDEDMNSFKADVKGHGATNDLTFTEEV DMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTAR ALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSY LTSYQPPQNPYYYVDGDVDHHHHHH
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      35 to 651
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 35 to 651. The signal and propeptide peptides are not included.

Specifications

Our Abpromise guarantee covers the use of ab194042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names

    • AW108094
    • H3P
    • Inter alpha (globulin) inhibitor, H3 polypeptide
    • Inter alpha inhibitor heavy chain 3
    • Inter alpha trypsin inhibitor heavy chain H3
    • Intin3
    • ITI HC3
    • ITI heavy chain H3
    • PAIHC3
    • Pre alpha-inhibitor, heavy chain 3
    • Serum derived hyaluronan-associated protein
    • SHAP
    see all
  • Relevance

    The inter-alpha-trypsin inhibitors (ITI) are a family of structurally related plasma serine protease inhibitors involved in extracellular matrix stabilization and in prevention of tumor metastasis. ITIH3 may act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.
  • Cellular localization

    Secreted

References

ab194042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up