Description

  • Product name

    Recombinant Human ITLN1 protein
    See all ITLN1 proteins and peptides
  • Purity

    > 90 % Densitometry.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRGSHHHHHHGMASTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDG LYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQ GSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPN KSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNG PVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGM RVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYS
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      19 to 298
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 19 to 298. The signal peptide and propeptide are not included.

Specifications

Our Abpromise guarantee covers the use of ab207144 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.24% Tris, 0.29% Sodium chloride

    Lyophilised from a 0.4 µm filtered solution.

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilised pellet dissolve completely.

General Info

  • Alternative names

    • Endothelial lectin HL 1
    • Endothelial lectin HL-1
    • FLJ20022
    • Galactofuranose binding lectin
    • Galactofuranose-binding lectin
    • hIntL
    • HL 1
    • HL-1
    • HL1
    • Intelectin
    • Intelectin 1
    • Intelectin-1
    • Intestinal lactoferrin receptor
    • INTL
    • ITLN
    • ITLN-1
    • ITLN1
    • ITLN1_HUMAN
    • LFR
    • Omentin
    • OTTHUMP00000027882
    see all
  • Function

    Has no effect on basal glucose uptake but enhances insulin-stimulated glucose uptake in adipocytes. Increases AKT phosphorylation in the absence and presence of insulin. May play a role in the defense system against microorganisms. May specifically recognize carbohydrate chains of pathogens and bacterial components containing galactofuranosyl residues, in a calcium-dependent manner. May be involved in iron metabolism.
  • Tissue specificity

    Highly expressed in omental adipose tissue where it is found in stromal vascular cells but not in fat cells but is barely detectable in subcutaneous adipose tissue (at protein level). Highly expressed in the small intestine. Also found in the heart, testis, colon, salivary gland, skeletal muscle, pancreas and thyroid and, to a lesser degree, in the uterus, spleen, prostate, lymph node and thymus.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Developmental stage

    Found in fetal small intestine and thymus.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell membrane. Secreted. Enriched in lipid rafts.
  • Information by UniProt

Images

  • 12% SDS-PAGE analysis of ab207144.
    Lane 1: Reduced and heated sample, 5μg/lane
    Lane 2: Non-reduced and non-heated sample, 5μg/lane.

References

ab207144 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207144.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up