Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKD SSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKR RSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIR KIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHG FAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVL LGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV
    • Molecular weight

      60 kDa including tags
    • Amino acids

      1 to 289

Specifications

Our Abpromise guarantee covers the use of ab132911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C6orf71
    • DEHAL1
    • dJ422F24.1
    • Iodotyrosine dehalogenase 1
    • iodotyrosine deiodinase
    • IYD
    • IYD-1
    • IYD1_HUMAN
    • OTTHUMP00000017973
    • OTTHUMP00000237263
    • OTTHUMP00000237264
    • OTTHUMP00000237265
    • OTTHUMP00000237266
    • OTTHUMP00000237267
    • TDH4
    see all
  • Function

    Catalyzes the oxidative NADPH-dependent deiodination of monoiodotyrosine (L-MIT) or diiodotyrosine (L-DIT). Acts during the hydrolysis of thyroglobulin to liberate iodide, which can then reenter the hormone-producing pathways. Acts more efficiently on monoiodotyrosine than on diiodotyrosine.
  • Tissue specificity

    Expressed at a high level in thyroid gland and at lower level in kidney and trachea.
  • Involvement in disease

    Defects in IYD are the cause of congenital hypothyroidism due to dyshormonogenesis type 4 (CHDH4) [MIM:274800]; also known as genetic defect in thyroid hormonogenesis type 4 or iodotyrosine dehalogenase deficiency or deiodinase deficiency. Patients with this defect present a phenotype of severe hypothyroidism, goiter, excessive levels of iodotyrosine in serum and urine, and variable mental deficits derived from unrecognized hypothyroidism.
  • Sequence similarities

    Belongs to the nitroreductase family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132911, stained with Coomassie Blue.

References

ab132911 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up