Description

  • Product name

    Recombinant Human IZUMO4 protein
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HGCLHCHSNFSKKFSFYRHHVNFKSWWVGDIPVSGALLTDWSDDTMKELH LAIPAKITREKLDQVATAVYQMMDQLYQGKMYFPGYFPNELRNIFREQVH LIQNAIIESRIDCQHRCGIFQYETISCNNCTDSHVACFGYNCESSAQWKS AVQGLLNYINNWHKQDTSMSLVSPALRCLEPPHLANLTLEDAAECLKQHV DDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      50 kDa including tags
    • Amino acids

      16 to 214
    • Additional sequence information

      Fused with a FC tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab196091 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    Lyophilized from a 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles

General Info

  • Alternative names

    • C19orf36
    • IMAGE:4215339
    • IZUM4_HUMAN
    • IZUMO family member 4
    • Izumo sperm-egg fusion protein 4
    • IZUMO4
    • putative SAMP14 binding protein variant 1
    • putative SAMP14 binding protein variant 2
    • Sperm 22 kDa protein c113
    • UNQ831/PRO1758
    see all
  • Tissue specificity

    Detected in sperm.
  • Sequence similarities

    Belongs to the Izumo family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab196091 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196091.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up