Overview

  • Product name
    Recombinant Human JAB1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHH YFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPV EGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGI DVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGP SEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTL SSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKL AKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS
    • Molecular weight
      62 kDa including tags
    • Amino acids
      1 to 334

Specifications

Our Abpromise guarantee covers the use of ab131744 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Note: Reduced Glutathione

General Info

  • Alternative names
    • 38 kDa Mov34 homolog
    • COP9 (constitutive photomorphogenic) homolog subunit 5
    • COP9 constitutive photomorphogenic homolog subunit 5
    • COP9 signalosome complex subunit 5
    • COP9 signalosome subunit 5
    • Cop9 subunit 5
    • COPS 5
    • cops5
    • CSN 5
    • CSN5
    • CSN5_HUMAN
    • JAB 1
    • Jun activation domain binding protein
    • Jun activation domain binding protein 1
    • Jun activation domain-binding protein 1
    • MGC3149
    • MOV 34
    • MOV34
    • MOV34 family, 38-KD member
    • SGN 5
    • SGN5
    • Signalosome subunit 5
    see all
  • Function
    Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of the SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. In the complex, it probably acts as the catalytic center that mediates the cleavage of Nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. Interacts directly with a large number of proteins that are regulated by the CSN complex, confirming a key role in the complex.
  • Sequence similarities
    Belongs to the peptidase M67A family. CSN5 subfamily.
    Contains 1 MPN (JAB/Mov34) domain.
  • Domain
    The JAMM motif is essential for the protease activity of the CSN complex resulting in deneddylation of cullins. It constitutes the catalytic center of the complex.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE ana;ysis of ab131744, stained with Coomassie Blue.

References

ab131744 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131744.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up