Recombinant Human Jagged 2/JAG2 protein (ab114541)
Key features and details
- Expression system: Wheat germ
- Suitable for: WB, ELISA, SDS-PAGE
Description
-
Product name
Recombinant Human Jagged 2/JAG2 protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAG MINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKF -
Predicted molecular weight
36 kDa including tags -
Amino acids
121 to 210
-
Specifications
Our Abpromise guarantee covers the use of ab114541 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
SDS-PAGE
-
Form
Liquid -
Additional notes
This product was previously labelled as Jagged 2.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- D12Ggc2e
- HJ 2
- HJ2
see all -
Relevance
Jagged 2 is a Notch ligand involved in the mediation of Notch signaling. Jagged 2 is expressed in heart, placenta and skeletal muscle and to a lesser extend in pancreas. Very low expression in brain, lung, liver and kidney. The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. Jagged 2 is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for Jagged 2. -
Cellular localization
Cell Membrane
Images
-
SDS-PAGE - Recombinant Human Jagged 2/JAG2 protein (ab114541)ab114541 on a 12.5% SDS-PAGE Stained with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab114541 has not yet been referenced specifically in any publications.
