Overview

  • Product name
    Recombinant human JAK1 protein (Active)
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESG GNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLK EYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEH QVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVW SFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLP CPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
    • Molecular weight
      59 kDa including tags
    • Amino acids
      866 to 1154
    • Tags
      GST tag N-Terminus
    • Additional sequence information
      NM_002227.

Specifications

Our Abpromise guarantee covers the use of ab216194 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: 1.0 pmol/min/μg.

    Assay Conditions: Enzyme reaction is conducted at 30°C for 1 hour in a buffer containing 50 mM HEPES (pH 7.5), 10 mM MgCl2, 1 mM EGTA, 200 μM ATP, 0.01% Brij-35 and 2 μM substrate (Tyr6) using Z-Lyte assay conditions.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >= 35 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 0.49% Glutathione, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • JAK 1
    • JAK 1A
    • JAK 1B
    • JAK-1
    • JAK1
    • JAK1_HUMAN
    • JAK1A
    • JAK1B
    • Janus kinase 1
    • Janus kinase 1 (a protein tyrosine kinase)
    • JTK3
    • Tyrosine protein kinase JAK 1
    • Tyrosine protein kinase JAK1
    • Tyrosine-protein kinase JAK1
    see all
  • Function
    Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor.
  • Tissue specificity
    Expressed at higher levels in primary colon tumors than in normal colon tissue. The expression level in metastatic colon tumors is comparable to the expression level in normal colon tissue.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.
    Contains 1 FERM domain.
    Contains 1 protein kinase domain.
    Contains 1 SH2 domain.
  • Domain
    Possesses two phosphotransferase domains. The second one probably contains the catalytic domain (By similarity), while the presence of slight differences suggest a different role for domain 1.
    The FERM domain mediates interaction with JAKMIP1.
  • Cellular localization
    Endomembrane system. Wholly intracellular, possibly membrane associated.
  • Information by UniProt

Images

  • Example of specific activity of ab216194.

  • 10% SDS-PAGE with Coomassie staining:

    Lane 1: ab216194

    Lane 2: MW marker

References

ab216194 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216194.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up