Overview

  • Product name

    Recombinant Human JM4/PRAF2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLL CFGIGLALAGYVRPLHTLLSALVVAVALGVLVWAAETRAAVRRCRRSHPA ACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASLRLRNLKNKIE NKIESIGLKRTPMGLLLEALGQEQEAGS
    • Amino acids

      1 to 178
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as JM4

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Jena Muenchen 4
    • JM 4
    • PRA1 domain family member 2
    • PRA1 family protein 2
    • PRAF2
    • PRAF2_HUMAN
    see all
  • Function

    May be involved in ER/Golgi transport and vesicular traffic. Plays a proapoptic role in cerulenin-induced neuroblastoma apoptosis.
  • Tissue specificity

    Strong expression in the brain, small intestine, lung, spleen, and pancreas as well as in tumor tissues of the breast, colon, lung and ovary, with a weaker expression in normal tissues of the same patient. High expression in neuroblastic tumors. Strongly expressed in Purkinje cells and more moderately in cells of the molecular and the granular layers in the cerebellum. Detected in neuronal cells, but not in non-neuronal cells in the cerebral cortex, hippocampus, and lateral ventricles.
  • Sequence similarities

    Belongs to the PRA1 family.
  • Cellular localization

    Endosome membrane.
  • Information by UniProt

Images

  • ab161360 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up