Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKLDLGEKVERSVVTLLQ RATELFYEGRRDECLQSSEVILDYSWEKLNTGTWQDVDKDWRRVYAIGCL LKALCLCQAPEDANTVAAALRVCDMGLLMGAAILGDILLKVAAILQTHLP GKRPARGSLPEQPCTKKARADHGLIPDVKLEKTVPRLHRPSLQHFREQFL VPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQ TLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDG EEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALY PHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWH YVRALDLSFSVSFWWS
    • Molecular weight

      72 kDa including tags
    • Amino acids

      1 to 416
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132413 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ13798
    • JmjC domain-containing protein 5
    • JMJD5
    • JMJD5 protein
    • jumonji domain containing 5
    • Jumonji domain-containing protein 5
    • KDM8_HUMAN
    • Lysine (K) specific demethylase 8
    • Lysine-specific demethylase 8
    see all
  • Function

    Histone demethylase required for G2/M phase cell cycle progression. Specifically demethylates dimethylated 'Lys-36' (H3K36me2) of histone H3, an epigenetic repressive mark, thereby acting as a transcription activator. Regulates expression of CCNA1 (cyclin-A1), leading to regulate cancer cell proliferation.
  • Tissue specificity

    Weakly expressed in most cells. Highly expressed in breast cancer cells.
  • Sequence similarities

    Contains 1 JmjC domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132413, stained with Coomassie Blue.

References

ab132413 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132413.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up