Overview

  • Product name

    Recombinant Human JOSD1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMVTPHKKSMLGNGNYDVNVIMAALQTK GYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVR EVGGAYYNLDSKLMSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCA LHALNNVFQDSNAFTRDTLQEIFQRLSPNTKMPEWIGGESELRKFLKHHL RGKNCELLLVVPEEVEAHQSWRTDV
    • Molecular weight

      26 kDa including tags
    • Amino acids

      1 to 202
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab134897 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as JOSD1, Josephin-1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.08% DTT, 0.32% Tris HCl, 0.06% EDTA, 40% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • dJ508I15.2
    • JOS1_HUMAN
    • Josd1
    • Josephin 1
    • Josephin domain containing 1
    • Josephin domain-containing 1
    • Josephin-1
    • KIAA0063
    • OTTHUMP00000198984
    • OTTHUMP00000239365
    see all
  • Function

    Has low protease activity towards poly-ubiquitin chains (in vitro). May act as a deubiquitinating enzyme.
  • Sequence similarities

    Contains 1 Josephin domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134897.

References

ab134897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up