Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      ASKPAAGKSRGEKRKRVVLTLKEKIDICTRLEKGESRKALMQEYNVGMST LYDIRAHKAQLLRFFASSDSNKALEQRRTLHTPKLEHLDRVLYEWFLGK
    • Amino acids

      2 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Jerky
    • Jerky (mouse) homolog
    • Jerky homolog (mouse)
    • JH8
    • Jrk helix turn helix protein
    • Jrk homolog
    see all
  • Relevance

    The JRK gene is the human homolog of the mouse jerky gene. The encoded protein has similarity to several nuclear regulatory proteins, including centromere protein B, which indicates that it might function as a DNA binding protein. Insertional inactivation of this gene in transgenic mice results in epileptic seizures. JRK is a strong candidate for Childhood Absence Epilepsy (CAE) as it has been mapped to the same chromosomal location (8q24.3). Two transcript variants encoding different isoforms have been found for this gene.
  • Cellular localization

    Nuclear

Images

  • ab160122 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160122 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160122.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up