Recombinant Human Junctional Adhesion Molecule 1/JAM-A protein (ab151859)

Description

  • Product name

    Recombinant Human Junctional Adhesion Molecule 1/JAM-A protein
    See all Junctional Adhesion Molecule 1/JAM-A proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNN KITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLI VLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNP KSTRAFSNSSYVLNPTTGELVFDPLSASDTGEYSCEARNGYGTPMTSNAV RMEAVERNVGVDHHHHHH
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      28 to 238
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.50
    Constituents: 0.75% Glycine, 0.32% Tris HCl, 0.29% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names

    • CD 321
    • CD321
    • CD321 antigen
    • ESTM33
    • F11 receptor
    • F11R
    • JAM
    • JAM 1
    • JAM A
    • JAM-1
    • JAM-A
    • JAM1
    • JAM1_HUMAN
    • JAMA
    • JCAM
    • Jcam1
    • Junction adhesion molecule 1
    • Junction adhesion molecule, mouse, homolog of
    • Junctional adhesion molecule 1
    • Junctional adhesion molecule A
    • KAT
    • Ly106
    • PAM 1
    • PAM-1
    • PAM1
    • Platelet adhesion molecule
    • Platelet adhesion molecule 1
    • Platelet F11 receptor
    • PRO301
    • UNQ264
    see all
  • Function

    Seems to plays a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly (By similarity). Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Involved in platelet activation. In case of orthoreovirus infection, serves as receptor for the virus.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cell junction > tight junction. Cell membrane. Localized at tight junctions of both epithelial and endothelial cells.
  • Information by UniProt

References

ab151859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up