Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQT LQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTL EVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLEN PRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGK RMQVDDLNVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
    • Molecular weight

      50 kDa including tags
    • Amino acids

      29 to 236
    • Additional sequence information

      Fused with a FC tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab192298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Junctional Adhesion Molecule 2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names

    • C21orf43
    • CD 322
    • CD322
    • CD322 antigen
    • JAM 2
    • JAM B
    • JAM IT/VE JAM
    • JAM, vascular endothelial
    • JAM-2
    • JAM-B
    • JAM2
    • JAM2_HUMAN
    • JAMB
    • Jcam2
    • Junction adhesion molecule 2
    • Junction adhesion molecule B
    • Junctional adhesion molecule 2
    • Junctional adhesion molecule B
    • PRO 245
    • PRO245
    • Vascular endothelial junction associated molecule
    • Vascular endothelial junction-associated molecule
    • VE JAM
    • VE-JAM
    • VEJAM
    see all
  • Function

    May play a role in the processes of lymphocyte homing to secondary lymphoid organs.
  • Tissue specificity

    Highest expression in the heart, placenta, lung, foreskin and lymph node. Prominently expressed on high endothelial venules, also present on the endothelia of other vessels. Localized to the intercellular boundaries of high endothelial cells.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell junction > tight junction. Cell membrane. Localized at tight junctions of both epithelial and endothelial cells.
  • Information by UniProt

References

ab192298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up