Recombinant Human Junctional Adhesion Molecule 2/JAM-B protein (Fc Chimera His Tag) (ab233603)

Description

  • Product name

    Recombinant Human Junctional Adhesion Molecule 2/JAM-B protein (Fc Chimera His Tag)
    See all Junctional Adhesion Molecule 2/JAM-B proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYY QQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDT VTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRL LENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRC PGKRMQVDDLNISLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHH HH
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      29 to 238
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hIgG-His-tag at C-terminus (NP_067042).

Specifications

Our Abpromise guarantee covers the use of ab233603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Junctional Adhesion Molecule 2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 50% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • C21orf43
    • CD 322
    • CD322
    • CD322 antigen
    • JAM 2
    • JAM B
    • JAM IT/VE JAM
    • JAM, vascular endothelial
    • JAM-2
    • JAM-B
    • JAM2
    • JAM2_HUMAN
    • JAMB
    • Jcam2
    • Junction adhesion molecule 2
    • Junction adhesion molecule B
    • Junctional adhesion molecule 2
    • Junctional adhesion molecule B
    • PRO 245
    • PRO245
    • Vascular endothelial junction associated molecule
    • Vascular endothelial junction-associated molecule
    • VE JAM
    • VE-JAM
    • VEJAM
    see all
  • Function

    May play a role in the processes of lymphocyte homing to secondary lymphoid organs.
  • Tissue specificity

    Highest expression in the heart, placenta, lung, foreskin and lymph node. Prominently expressed on high endothelial venules, also present on the endothelia of other vessels. Localized to the intercellular boundaries of high endothelial cells.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization

    Cell junction > tight junction. Cell membrane. Localized at tight junctions of both epithelial and endothelial cells.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab233603.

    MW: 50-70 kDa (SDS-PAGE under reducing conditions).

References

ab233603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up