Overview

  • Product name

    Recombinant Human JunD protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQN TELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
    • Molecular weight

      36 kDa including tags
    • Amino acids

      258 to 347

Specifications

Our Abpromise guarantee covers the use of ab152486 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Activator protein 1
    • AP 1
    • AP1
    • Jun D
    • jun D proto oncogene
    • Jund
    • JunD FL isoform
    • JUND_HUMAN
    • Transcription factor jun D
    • Transcription factor jun-D
    see all
  • Function

    Transcription factor binding AP-1 sites.
  • Sequence similarities

    Belongs to the bZIP family. Jun subfamily.
    Contains 1 bZIP domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152486 stained with Coomassie Blue.

References

ab152486 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152486.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up