Description

  • Product name

    Recombinant Human JWA protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVV AAMMISIVGFLSPF
    • Amino acids

      1 to 64
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Addicsin
    • ADP ribosylation factor like protein 6 interacting protein 5
    • ADP ribosylation like factor 6 interacting protein 5
    • ADP-ribosylation factor-like protein 6-interacting protein 5
    • Aip 5
    • Aip-5
    • Aip5
    • ARL 6 interacting protein 5
    • ARL-6-interacting protein 5
    • ARL6IP5
    • Cytoskeleton related vitamin A responsive protein
    • Cytoskeleton-related vitamin A-responsive protein
    • Dermal papilla derived protein 11
    • Dermal papilla-derived protein 11
    • DERP 11
    • DERP11
    • Glutamate transporter EAAC1-interacting protein
    • Glutamate transporter EEAC 1 associated protein
    • Glutamate transporter EEAC1 associated protein
    • GTRAP3 18
    • GTRAP3-18
    • Hp 22
    • Hp22
    • HSPC 127
    • HSPC127
    • JM 5
    • JM5
    • JMX
    • JWA
    • PRA 1 domain family 3
    • PRA 2
    • PRA1 domain family 3
    • PRA1 family protein 3
    • PRA2
    • PRAF 3
    • PRAF3
    • PRAF3_HUMAN
    • Prenylated Rab acceptor protein 2
    • Protein JWa
    • Putative MAPK activating protein PM27
    • Putative MAPK-activating protein PM27
    see all
  • Function

    Regulates intracellular concentrations of taurine and glutamate. Negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate. May be involved in membrane traffic.
  • Sequence similarities

    Belongs to the PRA1 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Cytoplasm. Also exists as a soluble form in the cytoplasm. Associated with microtubules.
  • Information by UniProt

Images

  • ab161039 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up