Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      TLSTPLSKRTSGFPAKKRALELSGNSKNELNRSKRSWMWNQFFLLEEYTG SDYQYVGKLHSDQDRGDGSLKYILSGDGAGDLFIINENTGDIQATKRLDR EEKPVYILRAQAINRRTGRPVEPESEFIIKIHDINDNEPIFTKEVYTATV PEMSDVGTFVVQVTATDADDPTYGNSAKVVYSILQGQPYFSVESETGIIK TALLNMDRENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRF PQSTYQFKTPESSPPGTPIGRIKASDADVGENAEIEYSITDGEGLDMFDV ITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSA TVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNPVK YSVDRHTDMDRIFNIDSGNGSIFTSKLLDRETLLWHNITVIATEINNPKQ SSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPY SGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLPV VISDNDYPVQSSTGTVTVRVCACDHHGNMQSCHAEALIHPTGLSTGAVDH HHHHH
    • Molecular weight

      67 kDa including tags
    • Amino acids

      19 to 615
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151894 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 0.100 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab151894 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution.
  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as K Cadherin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • CAD6
    • CADH6_HUMAN
    • Cadherin 6
    • Cadherin 6 type 2
    • Cadherin 6 type 2 K cadherin (fetal kidney)
    • Cadherin fetal kidney
    • Cadherin-6
    • Cadherin6
    • CDH 6
    • Cdh6
    • K-cadherin
    • KCAD
    • Kidney cadherin
    see all
  • Function

    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
  • Tissue specificity

    Highly expressed in brain, cerebellum, and kidney. Lung, pancreas, and gastric mucosa show a weak expression. Also expressed in certain liver and kidney carcinomas.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab151894 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151894.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up