Description

  • Product name

    Recombinant Human K24 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AEYKQLLDIKTRLEVEIETYRRLLDGEGGGSSFAEFGGRNSGSVNMGSRD LVSGDSRSGSCSGQGRDSSKTRVTKTIVEELVDGKVVSSQVSSISEVKVK
    • Amino acids

      426 to 525
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165829 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as KRT24. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CK 24
    • Cytokeratin 24
    • FLJ20261
    • K24
    • KA24
    • Keratin 24
    • Keratin, type I cytoskeletal 24
    • KRT24
    • MGC138169
    • MGC138173
    • Type I keratin 24
    see all
  • Relevance

    K24 is a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, comprise the cytoskeleton of epithelial cells. K24 is highly expressed in keratinocytes, placenta, colon and spleen, and has been found to be up-regulated in the mucosa of patients suffering of colorectal cancer.
  • Cellular localization

    Intermediate filament; keratin

Images

  • ab165829 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165829 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165829.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up