Description

  • Product name

    Recombinant Human K25 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSLRLSSASRRSCPRPTTGSLRLYGGGTSFGTGNSCGISGIGSGFSSAFG GSSSGGNTGGGNPCAGFTVNERGLLSGNEKVTMQNLNDRLASYLDSVHAL EEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDDLKNQIIASTTS NANAVLQIDNARLTADDFRLKYENELALHQSVEADVNGLRRVLDEITLCR TDLEIQYETLSEEMTYLKKNHKEEMQVLQCAAGGNVNVEMNAAPGVDLTV LLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISEDVGATTSARNELT EMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEE QLHQVRTETEGQKLEYEQLLDIKLHLEKEIETYCLLIGGDDGACKSGGYK SKDYGSGNVGSQVKDPAKAIVVKKVLEEVDQRSKILTTRLHSLEEKSQSN
    • Amino acids

      1 to 450
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165549 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as KRT25.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CK 25
    • Cytokeratin 25
    • K25
    • K25A
    • Keratin 25
    • Keratin 25A
    • Keratin, type I cytoskeletal 25
    • KRT25
    • KRT25A
    • type I inner root sheath specific keratin 25 irs1
    • Type I inner root sheath specific keratin K25irs1
    see all
  • Relevance

    Essential for the proper assembly of type I and type II keratin protein complexes and formation of keratin intermediate filaments in the inner root sheath (irs).
  • Cellular localization

    Cytoplasmic

Images

  • ab165549 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165549 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165549.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up