Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLYAKPPPTINGIKGLQRKERLKPAHIHLQQLTCFSITCSSTMSYSCCLP SLGCRTSCSSRPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKE TMQFLNDRLASYLEKVRQLERDNAELEKLIQERSQQQEPLLCPSYQSYFK TIEELQQKILCAKAENARLVVNIDNAKLASDDFRSKYQTEQSLRLLVESD INSIRRILDELTLCKSDLESQVESLREELICLKKNHEEEVNTLRSQLGDR LNVEVDTAPTVDLNQVLNETRSQYEALVETNRREVEQWFATQTEELNKQV VSSSEQLQSCQAEIIELRRTVNALEIELQAQHNLRDSLENTLTESEAHYS SQLSQVQSLITNVESQLAEIRCDLERQNQEYQVLLDVRARLECEINTYRS LLESEDCKLPCNPCATTNASGNSCGPCGTSQKGCCN
    • Molecular weight

      76 kDa including tags
    • Amino acids

      1 to 436

Specifications

Our Abpromise guarantee covers the use of ab132808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as KRT34. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Ha 4
    • HA4
    • Hair keratin
    • Hair keratin, type I Ha4
    • Hard keratin type I 4
    • HHA4
    • HKA4
    • K34
    • Keratin
    • Keratin 34
    • Keratin, hair, acidic, 4
    • Keratin, type I cuticular Ha4
    • Keratin-34
    • KRT34
    • KRT34_HUMAN
    • KRTHA4
    • type I cuticular Ha4
    • type I Ha4
    see all
  • Tissue specificity

    Expressed in the hair follicle.
  • Sequence similarities

    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132808 stained with Coomassie Blue.

References

ab132808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up