Description

  • Product name

    Recombinant Human Kallikrein 10/K10 protein
    See all Kallikrein 10/K10 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab151628 is greater than 95% pure as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    > 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AEAALLPQNDTRLDPEAYGAPCARGSQPWQVSLFNGLSFHCAGVLVDQSW VLTAAHCGNK PLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLML LKLARPVVPG PRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKE CEVFYPGVVT NNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYT QICKYMSWIN KVIRSNVDHHHHHH
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      31 to 276
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151628 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Kallikrein 10

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride
    Note: Supplied as a 0.2 µm filtered solution.

General Info

  • Alternative names

    • Breast normal epithelial cell associated serine protease
    • Kallikrein related peptidase 10
    • Kallikrein-10
    • Kallikrein10
    • KLK 10
    • KLK10
    • KLK10_HUMAN
    • NES 1
    • NES1
    • Normal epithelial cell specific 1
    • Normal epithelial cell-specific 1
    • Protease serine like 1
    • Protease serine-like 1
    • PRSS L1
    • PRSSL 1
    • PRSSL1
    see all
  • Function

    Has a tumor-suppressor role for NES1 in breast and prostate cancer.
  • Tissue specificity

    Expressed in breast, ovary and prostate.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Developmental stage

    Down-regulated during breast cancer progression.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151628 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151628.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up