Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRILQLILLALATGLVGGETRIIKGFECKPHSQPWQAALFEKTRLLCGAT LIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNN SLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGST SSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQ GDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN
    • Molecular weight

      54 kDa including tags
    • Amino acids

      1 to 250

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Hippostasin
    • hK11
    • Kallikrein 11
    • Kallikrein 11 isoform 1 preproprotein
    • Kallikrein 11 isoform 2 precursor
    • Kallikrein 11 precursor
    • Kallikrein related peptidase 11
    • Kallikrein-11 inactive chain 2
    • KLK 11
    • Klk11
    • KLK11_HUMAN
    • MGC33060
    • Protease serine 20 trypsin like
    • Protease serine trypsin like
    • PRSS20
    • Serine protease 20
    • TLSP
    • Trypsin like protease
    • Trypsin-like protease
    see all
  • Function

    Possible multifunctional protease. Efficiently cleaves 'bz-Phe-Arg-4-methylcoumaryl-7-amide', a kallikrein substrate, and weakly cleaves other substrates for kallikrein and trypsin. Cleaves synthetic peptides after arginine but not lysine residues.
  • Tissue specificity

    Expressed in brain, skin and prostate. Isoform 1 is expressed preferentially in brain. Isoform 2 is expressed in prostate. Present in seminal plasma at concentrations ranging from 2 to 37 microg/mL (at protein level).
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications

    About 40% of KLK11 is inactivated by internal cleavage after Arg-188. This proteolytic inactivation may be effected by plasminogen.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue, showing ab132062 at approximately 53.9 kDa.

References

ab132062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up