Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MWLLLTLSFLLASTAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASL ISPHWVLSAAHCQSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEAR SHRNDIMLLRLVQPARLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEP GTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRG AESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWIRE TMKRN
    • Molecular weight

      54 kDa including tags
    • Amino acids

      1 to 255

Specifications

Our Abpromise guarantee covers the use of ab131931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ACO
    • ACO protease
    • EC 3.4.21.
    • HSRNASPH
    • Kallikrein 15 isoform CRA_d
    • Kallikrein like serine protease
    • Kallikrein related peptidase 15
    • Kallikrein-15
    • Kallikrein15
    • KLK 15
    • KLK15
    • KLK15 protein
    • KLK15_HUMAN
    • MGC129160
    • MGC129345
    • NSRNASPH
    • Prostin
    • Prostinogen
    see all
  • Function

    Protease whose physiological substrate is not yet known.
  • Tissue specificity

    Highest expression in the thyroid gland. Also expressed in the prostate, salivary, and adrenal glands and in the colon testis and kidney.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131931 stained with Coomassie Blue.

References

ab131931 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up