Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSIVGGWECEKHSQPWQVAVYSHGWAHCG GVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLY NMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTT CYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGL WTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRK WIKDTIAANP
    • Molecular weight
      29 kDa including tags
    • Amino acids
      25 to 261
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab167831 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • Glandular kallikrein 2
    • Glandular kallikrein-1
    • hGK 1
    • hGK-1
    • hK2
    • Kallikrein 2 prostatic
    • Kallikrein related peptidase 2
    • kallikrein, glandular
    • Kallikrein, prostatic
    • Kallikrein-2
    • KLK 2
    • Klk-2
    • Klk2
    • KLK2_HUMAN
    • KLK2A 2
    • KLK2A2
    • MGC12201
    • Tissue kallikrein 2
    • Tissue kallikrein-2
    • Ton
    see all
  • Function
    Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
  • Sequence similarities
    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab167831 (3µg).

References

ab167831 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up