Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHC GGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPL YNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGT TCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAG LWTGGKDTCGVSHPYSQHLEGKG
    • Molecular weight

      51 kDa including tags
    • Amino acids

      1 to 223

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

     This product was previously labelled as Kallikrein 2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Glandular kallikrein 2
    • Glandular kallikrein-1
    • hGK 1
    • hGK-1
    • hK2
    • Kallikrein 2 prostatic
    • Kallikrein related peptidase 2
    • kallikrein, glandular
    • Kallikrein, prostatic
    • Kallikrein-2
    • KLK 2
    • Klk-2
    • Klk2
    • KLK2_HUMAN
    • KLK2A 2
    • KLK2A2
    • MGC12201
    • Tissue kallikrein 2
    • Tissue kallikrein-2
    • Ton
    see all
  • Function

    Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132359 stained with Coomassie Blue.

References

ab132359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up