Overview

  • Product name

    Recombinant Human Kallikrein 4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SCSQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAAHCFQNS YTIGLGLHSL EADQEPGSQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSIS IASQCPTAGN SCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGG QDQKDSCNGD SGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQASVD HHHHHH
    • Molecular weight

      25 kDa including tags
    • Amino acids

      31 to 254
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151634 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab151634 is greater than 95% pure as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • 7S nerve growth factor alpha chain
    • AI2A1
    • Alpha-NGF
    • Androgen-regulated message 1
    • ARM1
    • EC 3.4.21.-
    • EMSP
    • EMSP 1
    • EMSP1
    • Enamel Matrix Serine Protease 1
    • Enamel matrix serine proteinase 1
    • HK4
    • Kallikrein
    • Kallikrein 1-related peptidase-like b4
    • Kallikrein 4
    • Kallikrein 4 (prostase, enamel matrix, prostate)
    • Kallikrein L1
    • Kallikrein like protein 1
    • Kallikrein related-peptidase 4 (prostase, enamel matrix, prostate)
    • Kallikrein-4
    • Kallikrein-like protein 1
    • Kallikrein-related peptidase 4
    • KLK 4
    • KLK L1
    • KLK-L1
    • KLK4
    • KLK4_HUMAN
    • MGC116827
    • MGC116828
    • Prostase
    • Protease Serine 17
    • PRSS 17
    • PRSS17
    • PSTS
    • Serine protease 17
    see all
  • Tissue specificity

    Expressed in prostate.
  • Involvement in disease

    Defects in KLK4 are the cause of amelogenesis imperfecta hypomaturation type 2A1 (AI2A1) [MIM:204700]. AI2A1 is an autosomal recessive defect of enamel formation. The disorder involves both primary and secondary dentitions. The teeth have a shiny agar jelly appearance and the enamel is softer than normal. Brown pigment is present in middle layers of enamel.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab151634 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151634.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up