Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADLIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKV FRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRI RPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLS QKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGD YPCARPNRPGVYTNLCKFTKWIQETIQANSHHHHHH
    • Molecular weight

      26 kDa including tags
    • Amino acids

      67 to 293
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_001070960.

Specifications

Our Abpromise guarantee covers the use of ab224785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab224785 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • HK5
    • Kallikrein 5
    • Kallikrein L2
    • Kallikrein like 2
    • Kallikrein like protein 2
    • Kallikrein related peptidase 5
    • Kallikrein-5
    • Kallikrein-like protein 2
    • Kallikrein5
    • KLK 5
    • KLK L2
    • KLK-L2
    • KLK5
    • KLK5_HUMAN
    • KLKL 2
    • KLKL2
    • SCTE
    • Stratum corneum tryptic enzyme
    • UNQ570/PRO1132
    see all
  • Function

    May be involved in desquamation.
  • Tissue specificity

    Expressed in skin, breast, brain and testis. Expressed at the stratum granulosum of palmar skin.
  • Sequence similarities

    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab224785.

    MW: 28-40 kDa (SDS-PAGE under reducing conditions).

References

ab224785 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up