Recombinant Human Kallikrein 6 protein (ab155642)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Human Kallikrein 6 protein
See all Kallikrein 6 proteins and peptides -
Purity
> 95 % SDS-PAGE.
Lyophilized from 0.22 µm filtered solution -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKP NLQVFLGKHNLRQRE SSQEQSSVVRAVIHPDYDAASHDQDIMLLRLAR PAKLSELIQPLPLERDCSANTTSCHIL GWGKTADGDFPDTIQCAYIHL VSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPL VCGDHLRGL VSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK -
Predicted molecular weight
26 kDa including tags -
Amino acids
17 to 244 -
Tags
His tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab155642 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilised -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% Trehalose -
ReconstitutionIt is recommended to reconstitute ab155642 in sterile PBS to a final concentration of 50 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. Avoid vigorous shaking or vortexing.
General Info
-
Alternative names
- Bssp
- hK 6
- hK6
see all -
Function
Serine protease which exhibits a preference for Arg over Lys in the substrate P1 position and for Ser or Pro in the P2 position. Shows activity against amyloid precursor protein, myelin basic protein, gelatin, casein and extracellular matrix proteins such as fibronectin, laminin, vitronectin and collagen. Degrades alpha-synuclein and prevents its polymerization, indicating that it may be involved in the pathogenesis of Parkinson disease and other synucleinopathies. May be involved in regulation of axon outgrowth following spinal cord injury. Tumor cells treated with a neutralizing KLK6 antibody migrate less than control cells, suggesting a role in invasion and metastasis. -
Tissue specificity
In fluids, highest levels found in milk of lactating women followed by cerebrospinal fluid, nipple aspirate fluid and breast cyst fluid. Also found in serum, seminal plasma and some amniotic fluids and breast tumor cytosolic extracts. Not detected in urine. At the tissue level, highest concentrations found in glandular tissues such as salivary glands followed by lung, colon, fallopian tube, placenta, breast, pituitary and kidney. Not detected in skin, spleen, bone, thyroid, heart, ureter, liver, muscle, endometrium, testis, pancreas, seminal vesicle, ovary, adrenals and prostate. In brain, detected in gray matter neurons (at protein level). Colocalizes with pathological inclusions such as Lewy bodies and glial cytoplasmic inclusions. Overexpressed in primary breast tumors but not expressed in metastatic tumors. -
Sequence similarities
Belongs to the peptidase S1 family. Kallikrein subfamily.
Contains 1 peptidase S1 domain. -
Post-translational
modificationsInactivated by autolytic cleavage after Arg-80. -
Cellular localization
Secreted. Nucleus > nucleolus. Cytoplasm. Mitochondrion. Microsome. In brain, detected in the nucleus of glial cells and in the nucleus and cytoplasm of neurons. Detected in the mitochondrial and microsomal fractions of HEK-293 cells and released into the cytoplasm following cell stress. - Information by UniProt
Images
Datasheets and documents
References
ab155642 has not yet been referenced specifically in any publications.