Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EEQNKLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKP NLQVFLGKHNLRQRE SSQEQSSVVRAVIHPDYDAASHDQDIMLLRLAR PAKLSELIQPLPLERDCSANTTSCHIL GWGKTADGDFPDTIQCAYIHL VSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPL VCGDHLRGL VSWGNIPCGSKEKPGVYTNVCRYTNWIQKTIQAK
    • Molecular weight
      26 kDa including tags
    • Amino acids
      17 to 244
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab155642 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Lyophilized from 0.22 µm filtered solution
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute ab155642 in sterile PBS to a final concentration of 50 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. Avoid vigorous shaking or vortexing.

General Info

  • Alternative names
    • Bssp
    • hK 6
    • hK6
    • Kallikrein 6 precursor
    • Kallikrein related peptidase 6
    • Kallikrein-6
    • Kallikrein6
    • KLK 6
    • Klk 7
    • KLK 9
    • Klk29
    • Klk6
    • KLK6_HUMAN
    • Klk7
    • KLK9
    • MGC9355
    • mGK 1
    • mGK1
    • MSP
    • Neurosin
    • Protease M
    • Protease serine 18
    • Protease serine 9
    • PRSS 18
    • PRSS 9
    • PRSS18
    • PRSS9
    • Serine protease 18
    • Serine protease 9
    • SP 59
    • SP59
    • Tissue kallikrein
    • TK
    • Zyme
    see all
  • Function
    Serine protease which exhibits a preference for Arg over Lys in the substrate P1 position and for Ser or Pro in the P2 position. Shows activity against amyloid precursor protein, myelin basic protein, gelatin, casein and extracellular matrix proteins such as fibronectin, laminin, vitronectin and collagen. Degrades alpha-synuclein and prevents its polymerization, indicating that it may be involved in the pathogenesis of Parkinson disease and other synucleinopathies. May be involved in regulation of axon outgrowth following spinal cord injury. Tumor cells treated with a neutralizing KLK6 antibody migrate less than control cells, suggesting a role in invasion and metastasis.
  • Tissue specificity
    In fluids, highest levels found in milk of lactating women followed by cerebrospinal fluid, nipple aspirate fluid and breast cyst fluid. Also found in serum, seminal plasma and some amniotic fluids and breast tumor cytosolic extracts. Not detected in urine. At the tissue level, highest concentrations found in glandular tissues such as salivary glands followed by lung, colon, fallopian tube, placenta, breast, pituitary and kidney. Not detected in skin, spleen, bone, thyroid, heart, ureter, liver, muscle, endometrium, testis, pancreas, seminal vesicle, ovary, adrenals and prostate. In brain, detected in gray matter neurons (at protein level). Colocalizes with pathological inclusions such as Lewy bodies and glial cytoplasmic inclusions. Overexpressed in primary breast tumors but not expressed in metastatic tumors.
  • Sequence similarities
    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Post-translational
    modifications
    Inactivated by autolytic cleavage after Arg-80.
  • Cellular localization
    Secreted. Nucleus > nucleolus. Cytoplasm. Mitochondrion. Microsome. In brain, detected in the nucleus of glial cells and in the nucleus and cytoplasm of neurons. Detected in the mitochondrial and microsomal fractions of HEK-293 cells and released into the cytoplasm following cell stress.
  • Information by UniProt

Images

  • SDS PAGE of reduced ab155642 stained overnight with Coomassie Blue. Protein migrates as 23 kDa or 33 kDa in reduced SDS-PAGE resulting from autolysis and glycosylation.

References

ab155642 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155642.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up