Overview

  • Product name
    Recombinant Human Kallikrein 9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGA TLISDRWLLTAAHCRKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFN KDLSANDHNDDIMLIRLPRQARLSPAVQPLNLSQTCVSPGMQCLISGWGA VSSPKALFPVTLQCANISILENKLCHWAYPGHISDSMLCAGLWEGGRGSC QGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHYLDWIQEIMEN
    • Amino acids
      1 to 250
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166174 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Kallikrein 8
    • Kallikrein 9
    • Kallikrein L3
    • Kallikrein Like 3
    • Kallikrein like protein 3
    • kallikrein related peptidase 9
    • Kallikrein-9
    • Kallikrein-like protein 3
    • Kallikrein8
    • Kallikrein9
    • KLK 8
    • KLK 9
    • KLK L3
    • KLK-L3
    • KLK8
    • KLK9
    • KLK9_HUMAN
    • KLKL 3
    • KLKL3
    see all
  • Tissue specificity
    Skin, thymus, trachea, cerebellum and spinal cord.
  • Sequence similarities
    Belongs to the peptidase S1 family. Kallikrein subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab166174 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166174 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166174.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up