Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASET PGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTELSESDVHRG FQHLLHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHT NFYDTVGTIQLINDHVKKETRGKIVDLVSELKKDVLMVLVNYIYFKALWE KPFISSRTTPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDY KGDATVFFILPNQGKMREIEEVLTPEMLMRWNNLLRKRNFYKKLELHLPK FSISGSYVLDQILPRLGFTDLFSKWADLSGITKQQKLEASKSFHKATLDV DEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFLGK VVDPTKP
    • Molecular weight

      46 kDa
    • Amino acids

      21 to 427
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Purity

    > 95 % SDS-PAGE.
    ab153781 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from an 0.2 µM filtered solution.
  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Kallistatin. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Dissolve the lyophilized protein in 1X PBS.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • KAIN_HUMAN
    • KAL
    • Kallikrein binding protein
    • Kallikrein inhibitor
    • Kallistatin
    • KBP
    • KLST
    • KST
    • MGC108582
    • Peptidase inhibitor 4
    • PI-4
    • PI4
    • Protease inhibitor 4
    • Protease inhibitor 4 (kallistatin)
    • Serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 4
    • Serpin A4
    • Serpin peptidase inhibitor clade A member 4
    • Serpin peptidase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 4
    • SERPINA4
    • Tissue kallistatin inhibitor
    see all
  • Function

    Inhibits human amidolytic and kininogenase activities of tissue kallikrein. Inhibition is achieved by formation of an equimolar, heat- and SDS-stable complex between the inhibitor and the enzyme, and generation of a small C-terminal fragment of the inhibitor due to cleavage at the reactive site by tissue kallikrein.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Sequence similarities

    Belongs to the serpin family.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab153781 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up