Overview

  • Product name
    Recombinant Human KALRN protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCL QHPWLQPHNGSYSKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRVN Q
    • Amino acids
      1187 to 1287
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Duo
    • FLJ16443
    • HAPIP
    • Huntingtin associated protein interacting protein (duo)
    • Huntingtin-associated protein-interacting protein
    • Kalirin
    • Kalirin (isoform 2)
    • KALRN
    • KALRN_HUMAN
    • Protein Duo
    • RhoGEF kinase
    • Serine/threonine kinase with Dbl and pleckstrin homology domains
    • Serine/threonine-protein kinase with Dbl- and pleckstrin homology domain
    • TRAD
    see all
  • Function
    Promotes the exchange of GDP by GTP. Activates specific Rho GTPase family members, thereby inducing various signaling mechanisms that regulate neuronal shape, growth, and plasticity, through their effects on the actin cytoskeleton. Induces lamellipodia independent of its GEF activity.
  • Tissue specificity
    Isoform 2 is brain specific. Highly expressed in cerebral cortex, putamen, amygdala, hippocampus and caudate nucleus. Weakly expressed in brain stem and cerebellum. Isoform 4 is expressed in skeletal muscle.
  • Involvement in disease
    Genetic variation in KALRN is associated with susceptibility to coronary heart disease type 5 (CHDS5) [MIM:608901]. CHD is the leading cause of death and disability worldwide. CHD is multifactorial disease with a strong genetic component. Classic epidemiologic studies have revealed many risk factors for CHD, including age, sex, hypertension, dyslipidemia, diabetes mellitus, smoking, and physical inactivity.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 CRAL-TRIO domain.
    Contains 2 DH (DBL-homology) domains.
    Contains 1 fibronectin type-III domain.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 2 PH domains.
    Contains 1 protein kinase domain.
    Contains 2 SH3 domains.
    Contains 5 spectrin repeats.
  • Domain
    The two GEF domains catalyze nucleotide exchange for RAC1 and RhoA which are bound by DH1 and DH2 respectively. The two GEF domains appear to play differing roles in neuronal development and axonal outgrowth. SH3 1 binds to the first GEF domain inhibiting GEF activity only when in the presence of a PXXP peptide, suggesting that the SH3 domain/peptide interaction mediates binding to GEF1. CRK1 SH3 domain binds to and inhibits GEF1 activity.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton. Associated with the cytoskeleton.
  • Information by UniProt

Images

  • ab160287 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160287 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up