Description

  • Product name

    Recombinant Human KAR protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLG EWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEISNYT
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 98

Specifications

Our Abpromise guarantee covers the use of ab132771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as HSD17B12. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 12,3-ketoacyl-CoA reductase,short chain
    • 17 beta HSD 12
    • 17 beta hydroxysteroid dehydrogenase 12
    • 17-@beta-HSD XII
    • 17-@beta-hydroxysteroid dehydrogenase XII
    • 17-beta-HSD 12
    • 17-beta-hydroxysteroid dehydrogenase 12
    • 17beta HSD type 12
    • 3 ketoacyl CoA reductase
    • 3-ketoacyl-CoA reductase
    • DHB12_HUMAN
    • Estradiol 17 beta dehydrogenase 12
    • Estradiol 17-beta-dehydrogenase 12
    • HSD17B12
    • Hydroxysteroid (17-beta) dehydrogenase 12
    • KAR
    • KIK-I
    • Kik1
    • SDR12C1
    • Short chain dehydrogenase/reductase family 12C member 1
    • Steroid dehydrogenase homolog
    see all
  • Function

    Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in women. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation.
  • Tissue specificity

    Expressed in most tissues tested. Highly expressed in the ovary and mammary. Expressed in platelets.
  • Pathway

    Steroid biosynthesis; estrogen biosynthesis.
    Lipid metabolism; fatty acid biosynthesis.
  • Sequence similarities

    Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily.
  • Domain

    The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132771 stained with Coomassie Blue.

References

ab132771 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up