Recombinant Human KAR protein (ab132771)
Key features and details
- Expression system: Wheat germ
- Suitable for: SDS-PAGE, ELISA, WB
Description
-
Product name
Recombinant Human KAR protein -
Expression system
Wheat germ -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLG EWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEISNYT -
Predicted molecular weight
37 kDa including tags -
Amino acids
1 to 98
-
Specifications
Our Abpromise guarantee covers the use of ab132771 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
ELISA
Western blot
-
Form
Liquid -
Additional notes
This product was previously labelled as HSD17B12.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- 12,3-ketoacyl-CoA reductase,short chain
- 17 beta HSD 12
- 17 beta hydroxysteroid dehydrogenase 12
see all -
Function
Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in women. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation. -
Tissue specificity
Expressed in most tissues tested. Highly expressed in the ovary and mammary. Expressed in platelets. -
Pathway
Steroid biosynthesis; estrogen biosynthesis.
Lipid metabolism; fatty acid biosynthesis. -
Sequence similarities
Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily. -
Domain
The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins. -
Cellular localization
Endoplasmic reticulum membrane. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human KAR protein (ab132771)12.5% SDS-PAGE analysis of ab132771 stained with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab132771 has not yet been referenced specifically in any publications.
