Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFCTNTNDFLSLLEKEVD FKPFGTLLHTYSVLSPTGGENFTFQIYKADMTCRGFREYHERLQTFLMWF IETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTR PRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLDITAEDPSKSYVKL RDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFKINKQHARRVYEIL RLLVTDMSDAEQYRSYRLDIKRRLISPYKKKQRDLAKMRKCLRPEELTNQ MNQIEISMQHEQLEESFQELVEDYRRVIERLAQE
    • Molecular weight

      62 kDa including tags
    • Amino acids

      1 to 334

Specifications

Our Abpromise guarantee covers the use of ab132096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HAT 1
    • hat1
    • HAT1_HUMAN
    • Histidine aminotransferase 1
    • Histone acetyltransferase 1
    • Histone acetyltransferase type B catalytic subunit
    • KAT1
    see all
  • Function

    Acetylates soluble but not nucleosomal histone H4 at 'Lys-5' (H4K5ac) and 'Lys-12' (H4K12ac) and, to a lesser extent, acetylates histone H2A at 'Lys-5' (H2AK5ac). Has intrinsic substrate specificity that modifies lysine in recognition sequence GXGKXG. May be involved in nucleosome assembly during DNA replication and repair as part of the histone H3.1 and H3.3 complexes. May play a role in DNA repair in response to free radical damage.
  • Sequence similarities

    Belongs to the HAT1 family.
  • Developmental stage

    Highly expressed in mitotic cells (at protein level).
  • Cellular localization

    Nucleus matrix and Cytoplasm. Nucleus. Nucleus matrix. Nucleus > nucleoplasm. Localization is predominantly nuclear in normal cells. Treatment with hydrogen peroxide or ionizing radiation enhances nuclear localization through redistribution of existing protein.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132096 stained with Coomassie Blue.

References

This product has been referenced in:

  • Moreno E  et al. Functional µ-Opioid-Galanin Receptor Heteromers in the Ventral Tegmental Area. J Neurosci 37:1176-1186 (2017). WB . Read more (PubMed: 28007761) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132096.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up