Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SMFSQQSPPHFGQQANTSMYSNNMNINVSMATNTGGMSSMNQMTGQISMT SVTSVPTSGLSSMGPEQVNDPALRGGNLFPNQLPGMDMIKQEGDTTRKYC
    • Amino acids
      1365 to 1464
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161026 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLHe75
    • Class E basic helix-loop-helix protein 75
    • glucocorticoid receptor interacting protein 1
    • GRIP 1
    • GRIP1
    • hTIF2
    • MED1
    • MGC138808
    • NCoA 2
    • NCoA-2
    • Ncoa2
    • NCOA2_HUMAN
    • Nuclear receptor coactivator 2
    • Oncogene FGR
    • p160
    • SRC 2
    • src2
    • Steroid receptor coactivator 2
    • TIF 2
    • TIF2
    • Transcriptional intermediary factor 2
    see all
  • Function
    Transcriptional coactivator for steroid receptors and nuclear receptors. Coactivator of the steroid binding domain (AF-2) but not of the modulating N-terminal domain (AF-1). Required with NCOA1 to control energy balance between white and brown adipose tissues.
  • Involvement in disease
    Note=Chromosomal aberrations involving NCOA2 may be a cause of acute myeloid leukemias. Inversion inv(8)(p11;q13) generates the KAT6A-NCOA2 oncogene, which consists of the N-terminal part of KAT6A and the C-terminal part of NCOA2/TIF2. KAT6A-NCOA2 binds to CREBBP and disrupts its function in transcription activation.
  • Sequence similarities
    Belongs to the SRC/p160 nuclear receptor coactivator family.
    Contains 1 bHLH (basic helix-loop-helix) domain.
    Contains 1 PAS (PER-ARNT-SIM) domain.
  • Domain
    Contains four Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs. The LXXLL motifs are essential for the association with nuclear receptors and are, at least in part, functionally redundant.
    The LLXXLXXXL motif is involved in transcriptional coactivation and CREBBP/CBP binding.
    Contains 2 C-terminal transcription activation domains (AD1 and AD2) that can function independently.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161026 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161026 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161026.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up