Description

  • Product name

    Recombinant human KAT2A / GCN5 protein
    See all KAT2A / GCN5 proteins and peptides
  • Biological activity

    Specific Activity: ≥70 pmole/min/µg.

     

  • Purity

    >= 47 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSM GGGSNSSLSLDSAGAEPMPGEKRTLPENLTLEDAKRLRVMGDIPMELVNE VMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPK ANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIG GICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFL TYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPY TELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGI RETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSE APDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPD SEYCRCASALEKFFYFKLKEGGLIDKDYKDDDDK
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      362 to 837
    • Tags

      DDDDK tag C-Terminus
    • Additional sequence information

      GenBank Accession No. NM_021078

Specifications

Our Abpromise guarantee covers the use of ab198084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.64% Tris HCl, 0.63% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

    80 ng/µl DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 1110051E14Rik
    • AW212720
    • EC 2.3.1.48
    • GCN 5
    • Gcn5
    • GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2
    • GCN5 general control of amino-acid synthesis 5-like 2 (yeast)
    • GCN5L2
    • general control of amino acid synthesis 5-like 2
    • General control of amino acid synthesis protein 5-like 2
    • General control of amino acid synthesis, yeast, homolog-like 2
    • HGCN5
    • Histone acetyltransferase GCN5
    • Histone acetyltransferase KAT2A
    • hsGCN5
    • K(lysine) acetyltransferase 2A
    • KAT2 A
    • KAT2A
    • KAT2A_HUMAN
    • Lysine acetyltransferase 2A
    • MGC102791
    • PCAF-b
    • STAF97
    see all
  • Function

    Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Acetylation of histones gives a specific tag for epigenetic transcription activation. Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
  • Tissue specificity

    Expressed in all tissues tested, with most abundant expression in ovary.
  • Sequence similarities

    Belongs to the GCN5 family.
    Contains 1 bromo domain.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS PAGE analysis of ab198084 (1.6 μg).

  • Activity assay for ab198084.

References

ab198084 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198084.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up