Description

  • Product name

    Recombinant Human KAT2A / GCN5 protein
    See all KAT2A / GCN5 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab111648 is purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGGGSNSSLSLDSAGAEPMPGEKRTLPENL TLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETA RLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGY GTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLG YIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVY PGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNL LAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTR KLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      411 to 837
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.08% DTT, 40% Glycerol, 1.17% Sodium chloride, 0.03% EDTA, 0.32% Tris HCl

General Info

  • Alternative names

    • 1110051E14Rik
    • AW212720
    • EC 2.3.1.48
    • GCN 5
    • Gcn5
    • GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2
    • GCN5 general control of amino-acid synthesis 5-like 2 (yeast)
    • GCN5L2
    • general control of amino acid synthesis 5-like 2
    • General control of amino acid synthesis protein 5-like 2
    • General control of amino acid synthesis, yeast, homolog-like 2
    • HGCN5
    • Histone acetyltransferase GCN5
    • Histone acetyltransferase KAT2A
    • hsGCN5
    • K(lysine) acetyltransferase 2A
    • KAT2 A
    • KAT2A
    • KAT2A_HUMAN
    • Lysine acetyltransferase 2A
    • MGC102791
    • PCAF-b
    • STAF97
    see all
  • Function

    Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Acetylation of histones gives a specific tag for epigenetic transcription activation. Has significant histone acetyltransferase activity with core histones, but not with nucleosome core particles. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
  • Tissue specificity

    Expressed in all tissues tested, with most abundant expression in ovary.
  • Sequence similarities

    Belongs to the GCN5 family.
    Contains 1 bromo domain.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab111648 (3 µg)

References

ab111648 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up