Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVI RFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCAN ILEKFFFSKIKEAGLID
    • Molecular weight
      41 kDa including tags
    • Amino acids
      714 to 831
    • Tags
      proprietary tag N-Terminus
    • Additional sequence information
      Bromodomain.

Specifications

Our Abpromise guarantee covers the use of ab176938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C.

    Information available upon request.

General Info

  • Alternative names
    • CAF
    • CREBBP associated factor
    • GCN5
    • GCN5L
    • GCN5L1
    • Histone acetylase PCAF
    • Histone acetyltransferase KAT2B
    • Histone acetyltransferase PCAF
    • K(lysine) acetyltransferase 2B
    • KAT2B
    • KAT2B_HUMAN
    • Lysine acetyltransferase 2B
    • P
    • P/CAF
    • p300/CBP associated factor
    • P300/CBP-associated factor
    • Pcaf
    see all
  • Function
    Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Has significant histone acetyltransferase activity with core histones (H3 and H4), and also with nucleosome core particles. Inhibits cell-cycle progression and counteracts the mitogenic activity of the adenoviral oncoprotein E1A. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes.
  • Tissue specificity
    Ubiquitously expressed but most abundant in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the GCN5 family.
    Contains 1 bromo domain.
    Contains 1 N-acetyltransferase domain.
  • Domain
    The bromodomain mediates binding to HIV-1 Tat.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab176938.

    Lane 1; 4 µg

    Lane 2; 2 µg

References

ab176938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up