Description

  • Product name

    Recombinant Human KAT3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDS NVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRG FGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGD EVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQEL ESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYE WLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK HLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKR DRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKW MTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWS VQKS
    • Amino acids

      1 to 454
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163375 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as CCBL2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CCBL 2
    • Cysteine conjugate beta lyase 2
    • Cysteine S conjugate beta lyase 2
    • Cysteine-S-conjugate beta-lyase 2
    • DKFZp547N1117
    • DKFZp667D0223
    • KAT 3
    • KAT III
    • KAT3
    • KAT3_HUMAN
    • KATIII
    • kyat3
    • Kynurenine aminotransferase 3
    • Kynurenine aminotransferase III
    • Kynurenine oxoglutarate transaminase 3
    • Kynurenine oxoglutarate transaminase III
    • Kynurenine--glyoxylate transaminase
    • Kynurenine--oxoglutarate transaminase 3
    • Kynurenine--oxoglutarate transaminase III
    • MGC9398
    • RBM1
    • RBMX L1
    • RBMXL 1
    • RBMXL1
    • RNA binding motif protein X linked like 1
    • RP11 82K18.3
    • RP4 531M19.2
    see all
  • Function

    Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity). Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro).
  • Sequence similarities

    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
  • Information by UniProt

Images

  • ab163375 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163375 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163375.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up