Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNT QDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSI AGDSDLDSDE
    • Amino acids
      1784 to 1893
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BA2R
    • CCG1
    • CCGS
    • Cell cycle G1 phase defect
    • Cell cycle gene 1 protein
    • Complementation of cell cycle block G1 to S
    • DYT3
    • N TAF1
    • NSCL2
    • OF
    • p250
    • TAF 1
    • TAF(II)250
    • TAF1
    • TAF1 RNA polymerase II TATA box binding protein (TBP) associated factor 250kDa
    • TAF1_HUMAN
    • TAF2A
    • TAFII-250
    • TAFII250
    • TATA box binding protein (TBP) associated factor RNA polymerase II A 250kD
    • TBP associated factor 250 kDa
    • TBP-associated factor 250 kDa
    • Transcription factor TFIID p250 polypeptide
    • Transcription initiation factor TFIID 250 kDa subunit
    • Transcription initiation factor TFIID subunit 1
    • XDP
    see all
  • Function
    Largest component and core scaffold of the TFIID basal transcription factor complex. Contains novel N- and C-terminal Ser/Thr kinase domains which can autophosphorylate or transphosphorylate other transcription factors. Phosphorylates TP53 on 'Thr-55' which leads to MDM2-mediated degradation of TP53. Phosphorylates GTF2A1 and GTF2F1 on Ser residues. Possesses DNA-binding activity. Essential for progression of the G1 phase of the cell cycle.
  • Involvement in disease
    Defects in TAF1 are the cause of dystonia type 3 (DYT3) [MIM:314250]; also called X-linked dystonia-parkinsonism (XDP). DYT3 is a X-linked dystonia-parkinsonism disorder. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT3 is characterized by severe progressive torsion dystonia followed by parkinsonism. Its prevalence is high in the Philippines. DYT3 has a well-defined pathology of extensive neuronal loss and mosaic gliosis in the striatum (caudate nucleus and putamen) which appears to resemble that in Huntington disease.
  • Sequence similarities
    Belongs to the TAF1 family.
    Contains 2 bromo domains.
    Contains 1 HMG box DNA-binding domain.
    Contains 2 protein kinase domains.
  • Post-translational
    modifications
    Phosphorylated by casein kinase II in vitro.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159623 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159623 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up