Recombinant Human KAT5 / Tip60 protein (ab161037)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDF NKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVKRKVE VVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDS SDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQ ELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFF EIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIV GYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTP EKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKK EDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHF TPKDWSKRGKW
    • Amino acids
      1 to 461
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 60 kDa Tat interactive protein
    • 60 kDa Tat-interactive protein
    • cPLA(2) interacting protein
    • cPLA(2)-interacting protein
    • cPLA2
    • cPLA2 interacting protein
    • ESA1
    • Histone acetyltransferase HTATIP
    • Histone acetyltransferase KAT5
    • HIV 1 Tat interactive protein
    • HIV 1 Tat interactive protein, 60kDa
    • HIV-1 Tat interactive protein
    • HTATIP
    • HTATIP1
    • K(lysine) acetyltransferase 5
    • K-acetyltransferase 5
    • KAT5
    • KAT5_HUMAN
    • Lysine acetyltransferase 5
    • PLIP
    • Tat interacting protein, 60kDa
    • TIP
    • Tip60
    see all
  • Function
    Catalytic subunit of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome-DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage. Directly acetylates and activates ATM. In case of HIV-1 infection, interaction with the viral Tat protein leads to KAT5 polyubiquitination and targets it to degradation.
  • Sequence similarities
    Belongs to the MYST (SAS/MOZ) family.
    Contains 1 C2HC-type zinc finger.
  • Post-translational
    modifications
    Sumoylated by UBE2I at Lys-430 and Lys-451, leading to increase of its histone acetyltransferase activity in UV-induced DNA damage response, as well as its translocation to nuclear bodies.
    Phosphorylated on Ser-86 and Ser-90; enhanced during G2/M phase. Phosphorylated form has a higher activity.
    Ubiquitinated by MDM2, leading to its proteasome-dependent degradation.
  • Cellular localization
    Nucleus > nucleolus. Cytoplasm > perinuclear region. Upon stimulation with EDN1, it is exported from the nucleus to the perinuclear region and UV irradiation induces translocation into punctuate subnuclear structures named nuclear bodies.
  • Information by UniProt

Images

  • ab161037 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up